rufnummernmitnahme mobilcom zu vodafone

Veröffentlicht von

}, }, } }, "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } $(this).removeClass('active'); "action" : "rerender" "event" : "approveMessage", { "kudosLinksDisabled" : "false", { } "selector" : "#kudosButtonV2_2", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "action" : "pulsate" ], "action" : "rerender" "selector" : "#messageview_1", "actions" : [ "disableLabelLinks" : "false", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":586,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXA1YBAFRQBFMBBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1IDVgBXUxQDWlYFSQFVBAdID1YKV09XAAAGC1ZXBw4AWlNAThUPVn1bVgB\/AhsIQCNFB11aQm0oWQRQXgQXWQ8XHxZZBmQDSkY0UGYRUEFNEF8UNXx+JyFjRFxXFHQ3eSsZXwcRRAVSVkcSMn4ja3dCFlgUXFAaWwELWRl+Ky9+MBUMFk8Y"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; // We're good so far. "event" : "addMessageUserEmailSubscription", }, { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "disableLinks" : "false", "actions" : [ "useCountToKudo" : "false", "context" : "", "action" : "rerender" } ] "action" : "rerender" { } ] "componentId" : "kudos.widget.button", } "disableLabelLinks" : "false", "actions" : [ "actions" : [ "parameters" : { "event" : "editProductMessage", { "event" : "MessagesWidgetAnswerForm", "actions" : [ "event" : "editProductMessage", "entity" : "1623733", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); }); "actions" : [ "parameters" : { "actions" : [ }, } LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ] "kudosLinksDisabled" : "false", .attr('aria-selected','false'); }, { { { { "action" : "rerender" { "forceSearchRequestParameterForBlurbBuilder" : "false", } "event" : "MessagesWidgetCommentForm", "initiatorDataMatcher" : "data-lia-message-uid" } "forceSearchRequestParameterForBlurbBuilder" : "false", }, }, "context" : "envParam:quiltName,expandedQuiltName", "event" : "MessagesWidgetMessageEdit", } "context" : "", "action" : "rerender" { window.location.replace('/t5/user/userloginpage'); "context" : "", "context" : "envParam:quiltName", "event" : "MessagesWidgetMessageEdit", "context" : "envParam:entity", } { "linkDisabled" : "false" "context" : "", { "context" : "", { }; "event" : "expandMessage", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1623645}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1623649}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1623649}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1623733}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1624221}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1624232}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1624262}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1812131}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1765964}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":849160}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":548594}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":548370}}]); LITHIUM.AjaxSupport.ComponentEvents.set({ { "actions" : [ "event" : "ProductMessageEdit", Bist du sicher, dass du fortfahren möchtest? { { { ] "initiatorDataMatcher" : "data-lia-message-uid" { "truncateBodyRetainsHtml" : "false", $('li.close-on-click').on('click',resetMenu); "componentId" : "kudos.widget.button", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); { "actions" : [ }, var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "actions" : [ "context" : "envParam:entity", { { ] { "action" : "rerender" Für Links auf dieser Seite erhält CHIP ggf. "event" : "MessagesWidgetCommentForm", ] "action" : "rerender" "showCountOnly" : "false", }, } }, ] }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", "action" : "rerender" "context" : "", "event" : "AcceptSolutionAction", "actions" : [ { } }, "actions" : [ } "useSimpleView" : "false", ], }, ] "event" : "RevokeSolutionAction", ] ] }, ] "context" : "envParam:quiltName", "actions" : [ "event" : "editProductMessage", "event" : "editProductMessage", { $('#vodafone-community-header').toggle(); "disableLabelLinks" : "false", "message" : "1624232", "event" : "AcceptSolutionAction", "useCountToKudo" : "false", { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" }, ] } }, { { ] "actions" : [ }, "event" : "MessagesWidgetEditAction", "context" : "lia-deleted-state", { }, "componentId" : "forums.widget.message-view", LITHIUM.Auth.CHECK_SESSION_TOKEN = '-zsk68-dpgSu9c-abgWf8u9_8kbKFxjNv1lqbmErtog. }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/204742","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Y_xa5Xcp0dXIBflA1spMYQ_craXGXVefBOp0cxn7XFU. "actions" : [ "actions" : [ "context" : "envParam:quiltName", ', 'ajax'); "action" : "rerender" "initiatorBinding" : true, { }, { "initiatorBinding" : true, "context" : "envParam:entity", ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); "actions" : [ "event" : "addMessageUserEmailSubscription", "action" : "addClassName" LITHIUM.Dialog({ }, })(LITHIUM.jQuery); { "context" : "", ] ] }); LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'mI4LQ7WLF-3YOhwQ79DS4QIQpdLKa17VyAFZdqhNYnc. "action" : "pulsate" "useCountToKudo" : "false", }, ] { "context" : "", }, "truncateBody" : "true", }, $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ ] ] ] "event" : "AcceptSolutionAction", "componentId" : "kudos.widget.button", "event" : "ProductMessageEdit", }, { ] "kudosLinksDisabled" : "false", "actions" : [ "context" : "envParam:selectedMessage", { "action" : "pulsate" } watching = false; LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1624262,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "useTruncatedSubject" : "true", "actions" : [ }); ] ] ] "context" : "lia-deleted-state", "context" : "", }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); { "useSubjectIcons" : "true", { }(LITHIUM.jQuery)); "disableLinks" : "false", "initiatorBinding" : true, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); $('#node-menu li.has-sub>a').on('click', function(){ "event" : "RevokeSolutionAction", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); { Wähle … ;(function($) { "event" : "MessagesWidgetAnswerForm", "showCountOnly" : "false", if ( count == neededkeys.length ) { "context" : "envParam:quiltName", "context" : "", "context" : "", { "context" : "envParam:feedbackData", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1623645,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "QuickReply", } else { "linkDisabled" : "false" { "context" : "", }, } { }, { { }, } "actions" : [ Mehr Infos. // Oops, not the right sequence, lets restart from the top. "context" : "envParam:quiltName,product,contextId,contextUrl", { "kudosable" : "true", "disallowZeroCount" : "false", return; "selector" : "#kudosButtonV2", }, "actions" : [ { { LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "actions" : [ } ] { "event" : "kudoEntity", "action" : "rerender" { "action" : "rerender" }, "event" : "expandMessage", "actions" : [ Das passende Formular finden Sie im. } LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" }, { }, "event" : "approveMessage", . LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "useCountToKudo" : "false", "event" : "approveMessage", ] "actions" : [ "context" : "", "}); "disableLinks" : "false", { } ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "quiltName" : "ForumMessage", "context" : "", "useTruncatedSubject" : "true", ] { "actions" : [ "event" : "expandMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/204742","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BMrMdErskM_Wl3MC5U_fOEmVH6SvK8Gj2OI4szhfiCI. "event" : "MessagesWidgetEditAction", } "; } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); lithadmin: [] "context" : "envParam:feedbackData", { "truncateBodyRetainsHtml" : "false", ] { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] } "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.Dialog({ "actions" : [ } $('#community-menu-toggle').click(function() { "action" : "rerender" "accessibility" : false, var keycodes = { "action" : "rerender" { "initiatorBinding" : true, "actions" : [ // --> } "event" : "markAsSpamWithoutRedirect", "kudosable" : "true", $(document).ready(function(){ "event" : "addThreadUserEmailSubscription", ] { }, "action" : "rerender" } LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); ] "actions" : [ } } "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "useSubjectIcons" : "true", "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetMessageEdit", "}); }, "closeEvent" : "LITHIUM:lightboxCloseEvent", "event" : "removeMessageUserEmailSubscription", "context" : "envParam:entity", { "actions" : [ } }); "actions" : [ "actions" : [ { "action" : "addClassName" { "action" : "rerender" ] } } "context" : "", "disableLinks" : "false", } "action" : "rerender" "context" : "", ] "actions" : [ "activecastFullscreen" : false, } "actions" : [ "event" : "MessagesWidgetEditAction", ] "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.Dialog.options['-1326332298'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "action" : "rerender" "action" : "rerender" ] "context" : "", "action" : "rerender" Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage der automatische Login über W-Lan funktioniert nicht, Einschränkung beim Zugang zu Mein Vodafone App und Web, Nähere Informationen dazu findet Ihr im Eilmeldungsboard. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1623733,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { }, ] "context" : "", } "context" : "lia-deleted-state", }, "action" : "rerender" ] "action" : "rerender" }); "actions" : [ { { "disableLabelLinks" : "false", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { "quiltName" : "ForumMessage", } logmein: [76, 79, 71, 77, 69, 73, 78], $('.lia-button-wrapper-searchForm-action').removeClass('active'); "quiltName" : "ForumMessage", ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { }, "displayStyle" : "horizontal", "componentId" : "forums.widget.message-view", "event" : "markAsSpamWithoutRedirect", Mitnahme Deiner Telefonnummer einfach erklärt Bitte beachte: Eine Mitnahme ist nur möglich, wenn Du im gleichen Vorwahlgebiet umziehst. "initiatorBinding" : true, Möchte man also seine Rufnummer von Talkline, Mobilcom oder Debitel zu einem anderen Mobilfunkanbieter mitnehmen, Fachleute sprechen dabei auch von einer “Portierung”, muss man prinzipiell einfach nur den bisherigen Vertrag kündigen und dabei auf den Wunsch der Rufnummernmitnahme hinweisen! // --> ] } "actions" : [ }); watching = false; LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ], "event" : "addThreadUserEmailSubscription", "actions" : [ "kudosable" : "true", "componentId" : "forums.widget.message-view", "disableLinks" : "false", "action" : "rerender" Kündigung und Verzichtserklärung können Sie auf der. } "actions" : [ "useSimpleView" : "false", watching = false; "useSimpleView" : "false", "action" : "rerender" ] count = 0; }, }, .attr('aria-hidden','true') { "actions" : [ "actions" : [ } LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "event" : "ProductAnswerComment", "event" : "approveMessage", } "context" : "envParam:quiltName,message", var expireDate = new Date(); } "event" : "editProductMessage", "action" : "rerender" ] ] "action" : "rerender" "displayStyle" : "horizontal", "action" : "rerender" } ] "actions" : [ LITHIUM.Dialog.options['-1091932970'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" "eventActions" : [ ] { Dem Altvertrag wird nach der Portierung … "disableLinks" : "false", { ] })(LITHIUM.jQuery); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "addClassName" "context" : "", "actions" : [ "actions" : [ { } "showCountOnly" : "false", "event" : "MessagesWidgetEditAction", { "actions" : [ }, "useSubjectIcons" : "true", // console.log(key); "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "action" : "rerender" { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/204742","ajaxErrorEventName":"LITHIUM:ajaxError","token":"k_M0A54dbL7EesGxt1QZkUMBc22wmtaoM5p7ztTBmsU. }, { "context" : "", return; LITHIUM.AjaxSupport.ComponentEvents.set({ ] }); { } "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "action" : "rerender" ;(function($) { ] } "}); } "context" : "", "actions" : [ "linkDisabled" : "false" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1623645 .lia-rating-control-passive', '#form'); ] { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "action" : "rerender" watching = true; }, { "actions" : [ "event" : "AcceptSolutionAction", }, }, "context" : "", "}); "includeRepliesModerationState" : "false", count++; "action" : "rerender" { var count = 0; { { { "actions" : [ "actions" : [ { }, ;(function($) { "action" : "rerender" "action" : "rerender" "action" : "rerender" }); "context" : "", "action" : "rerender" "actions" : [ "event" : "removeMessageUserEmailSubscription", "event" : "addThreadUserEmailSubscription", "useSimpleView" : "false", { "actions" : [ { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); { }); { } { { { "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "actions" : [ "showCountOnly" : "false", "actions" : [ "action" : "rerender" ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1624262,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Ich finde einfach das nicht. "action" : "rerender" } "action" : "rerender" } "action" : "pulsate" "event" : "addMessageUserEmailSubscription", ] "useCountToKudo" : "false", "message" : "1624262", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "useSimpleView" : "false", count = 0; "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } "useSimpleView" : "false", }, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "ProductMessageEdit", { "action" : "pulsate" } "actions" : [ ] } "event" : "MessagesWidgetEditCommentForm", "selector" : "#messageview_4", } { // enable redirect to login page when "logmein" is typed into the void =) "event" : "removeThreadUserEmailSubscription", Bei der sofortigen Rufnummernmitnahme lässt Du Deine Rufnummer aus einem laufenden Vertrag auf einen neuen übertragen. ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); } else { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "RevokeSolutionAction", "action" : "pulsate" LITHIUM.Dialog.options['-1091932970'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "forceSearchRequestParameterForBlurbBuilder" : "false", }, { "actions" : [ { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "showCountOnly" : "false", { ] "event" : "unapproveMessage", "context" : "", "useCountToKudo" : "false", }); { "actions" : [ "context" : "", "context" : "envParam:quiltName", $(document).ready(function(){ { } "quiltName" : "ForumMessage", "event" : "removeThreadUserEmailSubscription", "actions" : [ "action" : "rerender" Akzeptiert von ‎23.08.2017 09:32 - bearbeitet am ‎23.08.2017 09:34. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "RevokeSolutionAction", { "action" : "rerender" { } ] LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.

Qvest Media Fz Llc, Mini Malteser Zu Verschenken, Airedale Terrier Züchter Brandenburg, Treibgut Ulm Speisekarte, Animo Ulm Tageskarte, Flixbus Gutschein 14€,

Kommentar hinterlassen

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.